Sciurus carolinensis (gray squirrel): 124990332 Help Entry 124990332         CDS       T08117                                  Name (RefSeq) caveolin-1 isoform X1   KO K06278   caveolin 1 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04144   Endocytosis ncar04510   Focal adhesion ncar05020   Prion disease ncar05100   Bacterial invasion of epithelial cells ncar05205   Proteoglycans in cancer ncar05416   Viral myocarditis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124990332   09144 Cellular community - eukaryotes    04510 Focal adhesion     124990332  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     124990332   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124990332   09164 Neurodegenerative disease    05020 Prion disease     124990332   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124990332    05416 Viral myocarditis     124990332  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncar04131]     124990332 Membrane trafficking [BR:ncar04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     124990332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  124990332 NCBI-ProteinID:  XP_047416219 LinkDB All DBs Position 8:complement(36367766..36400264) Genome browser AA seq 147 aa AA seqDB search MADEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTT FTVTKYWFYRLLSTLFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIY VHTFCDPLFEAIGKIFSNIRINTQKEI NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcagacgagatgaacgagaagcaagtgtacgatgcgcacaccaaggagatcgacctg gtcaaccgcgaccccaagcatctcaacgacgacgtggtcaagattgactttgaagatgtg attgcagaaccagaagggacacacagtttcgacggcatctggaaagccagcttcaccacc ttcactgtgacaaaatactggttttaccgcttactgtccaccctttttggcatcccgatg gcgctcatctggggcatttactttgccattctctctttcctgcacatctgggcagttgta ccgtgcattaagagtttcctgattgagattcagtgcatcagtcgtgtttattccatctac gtccacaccttctgtgatccactctttgaagccattggcaaaatattcagcaatatccgc atcaacacgcagaaagaaatataa

DBGET integrated database retrieval system