Sciurus carolinensis (gray squirrel): 124990711 Help Entry 124990711         CDS       T08117                                  Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04072   Phospholipase D signaling pathway ncar04140   Autophagy - animal ncar04150   mTOR signaling pathway ncar04151   PI3K-Akt signaling pathway ncar04152   AMPK signaling pathway ncar04211   Longevity regulating pathway ncar04218   Cellular senescence ncar04714   Thermogenesis ncar04910   Insulin signaling pathway ncar04919   Thyroid hormone signaling pathway ncar05163   Human cytomegalovirus infection ncar05165   Human papillomavirus infection ncar05168   Herpes simplex virus 1 infection ncar05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     124990711    04151 PI3K-Akt signaling pathway     124990711    04152 AMPK signaling pathway     124990711    04150 mTOR signaling pathway     124990711  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124990711   09143 Cell growth and death    04218 Cellular senescence     124990711  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     124990711    04919 Thyroid hormone signaling pathway     124990711   09149 Aging    04211 Longevity regulating pathway     124990711   09159 Environmental adaptation    04714 Thermogenesis     124990711  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     124990711   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     124990711    05163 Human cytomegalovirus infection     124990711    05165 Human papillomavirus infection     124990711  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ncar04031]     124990711 GTP-binding proteins [BR:ncar04031]  Small (monomeric) G-proteins   Ras Family    Rheb     124990711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  124990711 NCBI-ProteinID:  XP_047416928 LinkDB All DBs Position 8:5753034..5801307 Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaagtcc tcattgacgattcagtttgttgaaggccagtttgtggactcctatgatccaaccatagaa aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattccatttttcctcagacatattccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattattggatatggtggggaaagtacaaatacctattatgttggttggaaataag aaagacctgcatatggaaagggtgatcagttacgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaggaaaatcagactgctgttgatgtattt agaaggataatattggaggcagaaaaaattgatggggcagcttcacaaggaaagtcttca tgctcggtgatgtaa

DBGET integrated database retrieval system