Sciurus carolinensis (gray squirrel): 124991717 Help Entry 124991717         CDS       T08117                                  Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar01522   Endocrine resistance ncar04010   MAPK signaling pathway ncar04012   ErbB signaling pathway ncar04024   cAMP signaling pathway ncar04137   Mitophagy - animal ncar04210   Apoptosis ncar04310   Wnt signaling pathway ncar04380   Osteoclast differentiation ncar04510   Focal adhesion ncar04530   Tight junction ncar04620   Toll-like receptor signaling pathway ncar04621   NOD-like receptor signaling pathway ncar04625   C-type lectin receptor signaling pathway ncar04657   IL-17 signaling pathway ncar04658   Th1 and Th2 cell differentiation ncar04659   Th17 cell differentiation ncar04660   T cell receptor signaling pathway ncar04662   B cell receptor signaling pathway ncar04668   TNF signaling pathway ncar04722   Neurotrophin signaling pathway ncar04912   GnRH signaling pathway ncar04915   Estrogen signaling pathway ncar04921   Oxytocin signaling pathway ncar04926   Relaxin signaling pathway ncar04932   Non-alcoholic fatty liver disease ncar04933   AGE-RAGE signaling pathway in diabetic complications ncar05030   Cocaine addiction ncar05031   Amphetamine addiction ncar05132   Salmonella infection ncar05133   Pertussis ncar05135   Yersinia infection ncar05140   Leishmaniasis ncar05142   Chagas disease ncar05161   Hepatitis B ncar05162   Measles ncar05166   Human T-cell leukemia virus 1 infection ncar05167   Kaposi sarcoma-associated herpesvirus infection ncar05169   Epstein-Barr virus infection ncar05170   Human immunodeficiency virus 1 infection ncar05171   Coronavirus disease - COVID-19 ncar05200   Pathways in cancer ncar05203   Viral carcinogenesis ncar05207   Chemical carcinogenesis - receptor activation ncar05208   Chemical carcinogenesis - reactive oxygen species ncar05210   Colorectal cancer ncar05211   Renal cell carcinoma ncar05224   Breast cancer ncar05231   Choline metabolism in cancer ncar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ncar05321   Inflammatory bowel disease ncar05323   Rheumatoid arthritis ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124991717    04012 ErbB signaling pathway     124991717    04310 Wnt signaling pathway     124991717    04668 TNF signaling pathway     124991717    04024 cAMP signaling pathway     124991717  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     124991717   09143 Cell growth and death    04210 Apoptosis     124991717   09144 Cellular community - eukaryotes    04510 Focal adhesion     124991717    04530 Tight junction     124991717  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124991717    04621 NOD-like receptor signaling pathway     124991717    04625 C-type lectin receptor signaling pathway     124991717    04660 T cell receptor signaling pathway     124991717    04658 Th1 and Th2 cell differentiation     124991717    04659 Th17 cell differentiation     124991717    04657 IL-17 signaling pathway     124991717    04662 B cell receptor signaling pathway     124991717   09152 Endocrine system    04912 GnRH signaling pathway     124991717    04915 Estrogen signaling pathway     124991717    04921 Oxytocin signaling pathway     124991717    04926 Relaxin signaling pathway     124991717   09156 Nervous system    04722 Neurotrophin signaling pathway     124991717   09158 Development and regeneration    04380 Osteoclast differentiation     124991717  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124991717    05207 Chemical carcinogenesis - receptor activation     124991717    05208 Chemical carcinogenesis - reactive oxygen species     124991717    05203 Viral carcinogenesis     124991717    05231 Choline metabolism in cancer     124991717    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124991717   09162 Cancer: specific types    05210 Colorectal cancer     124991717    05211 Renal cell carcinoma     124991717    05224 Breast cancer     124991717   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124991717    05170 Human immunodeficiency virus 1 infection     124991717    05161 Hepatitis B     124991717    05171 Coronavirus disease - COVID-19     124991717    05162 Measles     124991717    05167 Kaposi sarcoma-associated herpesvirus infection     124991717    05169 Epstein-Barr virus infection     124991717   09171 Infectious disease: bacterial    05132 Salmonella infection     124991717    05135 Yersinia infection     124991717    05133 Pertussis     124991717   09174 Infectious disease: parasitic    05140 Leishmaniasis     124991717    05142 Chagas disease     124991717   09163 Immune disease    05323 Rheumatoid arthritis     124991717    05321 Inflammatory bowel disease     124991717   09165 Substance dependence    05030 Cocaine addiction     124991717    05031 Amphetamine addiction     124991717   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124991717    05418 Fluid shear stress and atherosclerosis     124991717   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     124991717    04933 AGE-RAGE signaling pathway in diabetic complications     124991717   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     124991717  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ncar03000]     124991717 Transcription factors [BR:ncar03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     124991717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha ATG16 DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  124991717 NCBI-ProteinID:  XP_047418429 LinkDB All DBs Position 1:162158667..162161367 Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLGFPAQPQQQQPPPQPPHHLPQQISVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctagccgacccggtgggcagcctgaaaccgcacctccgcgccaagaactcggacctt ctcacctcgcccgacgtagggctgctcaagttggcgtcgcccgagctggagcgcctgatc atccagtccagcaacgggcacatcactaccacgccgacccccacgcagttcctgtgcccc aagaacgtgactgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggcagag ctacatagccagaacacgctgcccagcgtcacgtcggctgcacagccggtcagcggggcg ggcatggtggctcccgcggtggcctcggtggcgggcggcagcggcagtggcggcttcagc gccagcctgcacagcgagccgccggtctacgctaacctcagcaacttcaacccgggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctgggctttcccgctcag ccccagcagcagcagccgccgccgcagccgccgcaccacctgccccagcagatctcggtg cagcacccgcggctgcaggccctgaaggaggagccgcagaccgtgcccgagatgcccggc gagacgccgcccctgtctcccatcgatatggagtcccaggagcgtatcaaggcggagagg aagcgtatgaggaaccgcattgccgcctccaagtgccggaaaaggaagctggagagaatc gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagctaaaacagaaagtcatgaaccacgttaac agcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system