Sciurus carolinensis (gray squirrel): 124993416 Help Entry 124993416         CDS       T08117                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04014   Ras signaling pathway ncar04015   Rap1 signaling pathway ncar04022   cGMP-PKG signaling pathway ncar04024   cAMP signaling pathway ncar04062   Chemokine signaling pathway ncar04071   Sphingolipid signaling pathway ncar04072   Phospholipase D signaling pathway ncar04081   Hormone signaling ncar04144   Endocytosis ncar04150   mTOR signaling pathway ncar04270   Vascular smooth muscle contraction ncar04310   Wnt signaling pathway ncar04350   TGF-beta signaling pathway ncar04360   Axon guidance ncar04510   Focal adhesion ncar04520   Adherens junction ncar04530   Tight junction ncar04611   Platelet activation ncar04621   NOD-like receptor signaling pathway ncar04625   C-type lectin receptor signaling pathway ncar04660   T cell receptor signaling pathway ncar04670   Leukocyte transendothelial migration ncar04722   Neurotrophin signaling pathway ncar04810   Regulation of actin cytoskeleton ncar04921   Oxytocin signaling pathway ncar04928   Parathyroid hormone synthesis, secretion and action ncar04972   Pancreatic secretion ncar05100   Bacterial invasion of epithelial cells ncar05132   Salmonella infection ncar05133   Pertussis ncar05135   Yersinia infection ncar05152   Tuberculosis ncar05163   Human cytomegalovirus infection ncar05200   Pathways in cancer ncar05203   Viral carcinogenesis ncar05205   Proteoglycans in cancer ncar05206   MicroRNAs in cancer ncar05210   Colorectal cancer ncar05417   Lipid and atherosclerosis ncar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     124993416    04015 Rap1 signaling pathway     124993416    04310 Wnt signaling pathway     124993416    04350 TGF-beta signaling pathway     124993416    04072 Phospholipase D signaling pathway     124993416    04071 Sphingolipid signaling pathway     124993416    04024 cAMP signaling pathway     124993416    04022 cGMP-PKG signaling pathway     124993416    04150 mTOR signaling pathway     124993416   09133 Signaling molecules and interaction    04081 Hormone signaling     124993416  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124993416   09144 Cellular community - eukaryotes    04510 Focal adhesion     124993416    04520 Adherens junction     124993416    04530 Tight junction     124993416   09142 Cell motility    04810 Regulation of actin cytoskeleton     124993416  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     124993416    04621 NOD-like receptor signaling pathway     124993416    04625 C-type lectin receptor signaling pathway     124993416    04660 T cell receptor signaling pathway     124993416    04670 Leukocyte transendothelial migration     124993416    04062 Chemokine signaling pathway     124993416   09152 Endocrine system    04921 Oxytocin signaling pathway     124993416    04928 Parathyroid hormone synthesis, secretion and action     124993416   09153 Circulatory system    04270 Vascular smooth muscle contraction     124993416   09154 Digestive system    04972 Pancreatic secretion     124993416   09156 Nervous system    04722 Neurotrophin signaling pathway     124993416   09158 Development and regeneration    04360 Axon guidance     124993416  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124993416    05206 MicroRNAs in cancer     124993416    05205 Proteoglycans in cancer     124993416    05203 Viral carcinogenesis     124993416   09162 Cancer: specific types    05210 Colorectal cancer     124993416   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     124993416   09171 Infectious disease: bacterial    05132 Salmonella infection     124993416    05135 Yersinia infection     124993416    05133 Pertussis     124993416    05152 Tuberculosis     124993416    05100 Bacterial invasion of epithelial cells     124993416   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124993416    05418 Fluid shear stress and atherosclerosis     124993416  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncar04131]     124993416   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncar04147]     124993416    04031 GTP-binding proteins [BR:ncar04031]     124993416 Membrane trafficking [BR:ncar04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     124993416 Exosome [BR:ncar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124993416   Exosomal proteins of other body fluids (saliva and urine)    124993416   Exosomal proteins of colorectal cancer cells    124993416   Exosomal proteins of bladder cancer cells    124993416 GTP-binding proteins [BR:ncar04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     124993416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  124993416 NCBI-ProteinID:  XP_047421193 LinkDB All DBs Position 9:28459657..28505448 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaattggtgattgttggtgatggagcatgtggcaagacatgc ttgctcatagttttcagcaaggaccagttcccagaagtatatgtgcccacagtgtttgag aactatgtggcagatattgaggtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagacactgatgttata ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggacc ccagaagtcaagcatttctgtcccaacgtacccatcatcctggttgggaataagaaggat cttcgtaatgatgagcacacaaggcgggagttagccaagatgaagcaggagccagtaaaa cctgaagaaggcagagatatggcaaacaggattggtgcctttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagctgctcttcaa gccagacgtgggaagaaaaaatctgggtgccttgtgttgtga

DBGET integrated database retrieval system