Sciurus carolinensis (gray squirrel): 124993501 Help Entry 124993501         CDS       T08117                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04024   cAMP signaling pathway ncar04080   Neuroactive ligand-receptor interaction ncar04081   Hormone signaling ncar04935   Growth hormone synthesis, secretion and action ncar04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     124993501   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     124993501    04081 Hormone signaling     124993501  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     124993501   09154 Digestive system    04971 Gastric acid secretion     124993501  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124993501 Cytokines and neuropeptides [BR:ncar04052]  Neuropeptides   GPCR binding    124993501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  124993501 NCBI-ProteinID:  XP_047421343 LinkDB All DBs Position 9:complement(57706157..57707513) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtgctggccctgggc ggtgtcaccggcgcgccctcggaccccagactccgtcagtttctgcagaagtccctggct gctgccgcaggaaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacggagaatgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gagatgaggctggagctgcagagatctgctaattcaaacccagctatggcaccccgagaa cgcaaggctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system