Sciurus carolinensis (gray squirrel): 124995014 Help Entry 124995014         CDS       T08117                                  Name (RefSeq) platelet factor 4-like   KO K05407   platelet factor 4 Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04060   Cytokine-cytokine receptor interaction ncar04061   Viral protein interaction with cytokine and cytokine receptor ncar04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ncar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124995014    04061 Viral protein interaction with cytokine and cytokine receptor     124995014  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     124995014  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncar04052]     124995014    00536 Glycosaminoglycan binding proteins [BR:ncar00536]     124995014 Cytokines and neuropeptides [BR:ncar04052]  Cytokines   Chemokines    124995014 Glycosaminoglycan binding proteins [BR:ncar00536]  Heparan sulfate / Heparin   Chemokines    124995014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CATSPERB_Ig-like Motif Other DBs NCBI-GeneID:  124995014 NCBI-ProteinID:  XP_047423353 LinkDB All DBs Position 10:complement(81455841..81457053) Genome browser AA seq 106 aa AA seqDB search MGLLWGSCGLRPQPRPGLLLVGLLLLPAVVTFASSVNPEEDGDLQCVCVKTTSQVHPKHI TSLEVIKAGPHCATAQMIATLKNGRKICLDRQVPLYKRVIRKLLES NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgggcctcctatggggctcctgcggcctccgcccccagcccaggcccgggctgctgctc gtggggctattgcttctaccagctgtggtcacattcgccagcagcgtgaaccctgaagaa gatggggacctgcagtgcgtgtgtgtgaagaccacctcccaagtccatcccaagcacatc accagcctggaggtgatcaaggccggaccccactgcgccaccgcccagatgatagctacg ctgaagaatgggaggaaaatttgcctggaccggcaggtccccctctacaagagagtaatc aggaaactcctggagagttag

DBGET integrated database retrieval system