Niveispirillum cyanobacteriorum: C0V82_02860 Help Entry C0V82_02860       CDS       T05262                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ncb  Niveispirillum cyanobacteriorum Pathway ncb01100   Metabolic pathways ncb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ncb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0V82_02860    00074 Mycolic acid biosynthesis     C0V82_02860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0V82_02860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AUN29300 UniProt:  A0A2K9N838 LinkDB All DBs Position eg_1:655296..655532 Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVVEHLGVDEAKVTDEASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA EKILTVKDAISFISAAKD NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgttgctgaacgcgtgaagaagatcgttgtcgagcacctgggcgtcgacgag gccaaggtcaccgacgaagccagcttcatcgacgatctgggcgccgacagcctggacacc gtcgagctggtcatggccttcgaggaagagttcggcatcgagatcccggacgacgccgct gagaagatcctgaccgttaaggacgccatttccttcatcagcgccgccaaggactga

DBGET integrated database retrieval system