Notothenia coriiceps (black rockcod): 104941019 Help Entry 104941019         CDS       T04920                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ncc  Notothenia coriiceps (black rockcod) Brite KEGG Orthology (KO) [BR:ncc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ncc03041]     104941019 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncc04052]     104941019 (ubl5) Spliceosome [BR:ncc03041]  Complex B   Other components    Complex B specific factors     104941019 (ubl5) Cytokines and neuropeptides [BR:ncc04052]  Neuropeptides   Neuropeptides (Unclassified)    104941019 (ubl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Rad60-SLD Motif Other DBs NCBI-GeneID:  104941019 NCBI-ProteinID:  XP_010764355 UniProt:  A0A6I9MSE8 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRFDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgcaacgatcgcctgggcaaaaaagtccgggttaaatgcaactct gaagatacgattggagatctgaagaagctcattgccgcccagacaggaacacgatttgac aaaatagttttaaagaaatggtataccatattcaaagaccacgtaaccctgggagactat gaaatccacgatgggatgaacctggagctgtactaccagtag

DBGET integrated database retrieval system