Notothenia coriiceps (black rockcod): 104946656 Help Entry 104946656         CDS       T04920                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04010   MAPK signaling pathway ncc04137   Mitophagy - animal ncc04140   Autophagy - animal ncc04218   Cellular senescence ncc04371   Apelin signaling pathway ncc04625   C-type lectin receptor signaling pathway ncc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ncc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104946656    04371 Apelin signaling pathway     104946656  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104946656    04137 Mitophagy - animal     104946656   09143 Cell growth and death    04218 Cellular senescence     104946656   09142 Cell motility    04810 Regulation of actin cytoskeleton     104946656  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104946656  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104946656    04031 GTP-binding proteins [BR:ncc04031]     104946656 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104946656   Exosomal proteins of bladder cancer cells    104946656 GTP-binding proteins [BR:ncc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104946656 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF6806 Motif Other DBs NCBI-GeneID:  104946656 NCBI-ProteinID:  XP_010770832 UniProt:  A0A6I9N2L9 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVGGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEHQRVVSTFMQLNGVA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgagtgcagaagaagaacgattcaaactggttgtggtgggtgggggcggggtggggaag agcgccctcaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatc gaggactcctacaccaagatctgcaccgttggggggaaggagacccggctggacatcctg gatacagcaggtcaggaggagtttggagcgatgagggagcagtacatgcgctcaggagaa ggctttctattggtgtttgcactcaacgaccggggcagctaccacgaggtgcagaagttc cacacgcagatcctgagagtgaaggaccgggatgacttccccatggtgctggttggaaac aaggcggacctggagcatcagagagtggtcagtaccttcatgcagcttaatggagtcgct tag

DBGET integrated database retrieval system