Notothenia coriiceps (black rockcod): 104951220 Help Entry 104951220         CDS       T04920                                  Name (RefSeq) claudin-like protein ZF-A89   KO K06087   claudin Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc03272   Virion - Hepatitis viruses ncc04382   Cornified envelope formation ncc04514   Cell adhesion molecules ncc04530   Tight junction Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104951220  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     104951220  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104951220  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104951220  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ncc03037]     104951220    04147 Exosome [BR:ncc04147]     104951220    04515 Cell adhesion molecules [BR:ncc04515]     104951220 Cilium and associated proteins [BR:ncc03037]  Other cilia and associated proteins   Stereociliary proteins    104951220 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104951220   Exosomal proteins of colorectal cancer cells    104951220 Cell adhesion molecules [BR:ncc04515]  Immunoglobulin superfamily   L1 family    104951220 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4153 DUF1218 DUF7544 DUF1129 DUF5676 Motif Other DBs NCBI-GeneID:  104951220 NCBI-ProteinID:  XP_010776158 UniProt:  A0A6I9NMA7 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MQCKVYDSMLALPLDLQAARALVVISILVALMGIMLAVAGGKCTNCIDDEEAKSKVAIAA GVFFIVSSILCIIPVSWSANTVLRNFYNPIMNDAQKRELGAALFIGWGASGLMLLGGALL CCQCPKSKDSGYSAKYSAPSSAASGGAYV NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcagtgcaaggtctacgactccatgctggctctgcccctcgaccttcaagctgcccgc gccctggttgtgatctccatcttggtggccttaatgggaatcatgctagctgttgcaggg ggaaaatgcaccaactgcattgacgatgaggaggccaagagtaaagtagccattgctgca ggtgtgttcttcatcgtgagcagtatcctgtgcatcatccctgtttcctggtctgccaac actgtcctcagaaacttctacaaccccattatgaacgacgctcagaagagggagctggga gccgcgctgttcatcggctggggagcatcaggacttatgctgcttggaggtgcacttctt tgctgccagtgcccgaagagtaaggacagcggatactcagccaaatactcagccccaagc tctgcagctagtggaggagcctacgtttga

DBGET integrated database retrieval system