Notothenia coriiceps (black rockcod): 104953684 Help Entry 104953684         CDS       T04920                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04382   Cornified envelope formation ncc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104953684  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104953684  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104953684 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of microglial cells    104953684 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH Motif Other DBs NCBI-GeneID:  104953684 NCBI-ProteinID:  XP_010778959 UniProt:  A0A6I9NMU9 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASKDGRSGTLSRRELRELMENELSNFLLSQKDPAAIDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQTHMKKQGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttctgaactggaaacagccatggagtccctcatcaaggtgttccaccgctacgcc tctaaggatgggagatccggcacactgagccgtcgagagctcagagagttgatggagaac gaactgtccaacttcctcctgtcccagaaggaccctgctgctattgacaaaatcatgaag gacctggacaccaacggtgatggccaggtggactttgaggagtttgtttctctggttgtt ggactttccattgcctgtgagcaatgctatcagacgcacatgaagaagcaggggaagaag taa

DBGET integrated database retrieval system