Notothenia coriiceps (black rockcod): 104954303 Help Entry 104954303         CDS       T04920                                  Name (RefSeq) somatostatin-1-like   KO K05237   somatostatin Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04080   Neuroactive ligand-receptor interaction ncc04081   Hormone signaling Brite KEGG Orthology (KO) [BR:ncc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     104954303    04081 Hormone signaling     104954303  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncc04052]     104954303 Cytokines and neuropeptides [BR:ncc04052]  Neuropeptides   GPCR binding    104954303 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  104954303 NCBI-ProteinID:  XP_010779696 UniProt:  A0A6I9NZ74 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MKPQELSRASLAELLLSDLLQENEALEEDGFPAAGEPENIRLDLERAAAAGPLLTPRERK AGCKNFFWKTFTSC NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaaccccaggagctgtcccgcgcgtcgctggccgagctgctgctgtccgacctgctg caggagaacgaggctctggaggaggacgggttccctgctgctggagaaccggagaacatc cgtttggatctggaacgcgccgccgccgccgggccgctgctgacccccagggagaggaag gccggctgcaagaacttcttctggaagaccttcacttcctgttaa

DBGET integrated database retrieval system