Notothenia coriiceps (black rockcod): 104955514 Help Entry 104955514         CDS       T04920                                  Name (RefSeq) ras-related protein Rab-8A-like   KO K07901   Ras-related protein Rab-8A Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04140   Autophagy - animal ncc04144   Endocytosis ncc04530   Tight junction Brite KEGG Orthology (KO) [BR:ncc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104955514    04140 Autophagy - animal     104955514   09144 Cellular community - eukaryotes    04530 Tight junction     104955514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncc04131]     104955514    03036 Chromosome and associated proteins [BR:ncc03036]     104955514   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104955514    04031 GTP-binding proteins [BR:ncc04031]     104955514 Membrane trafficking [BR:ncc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     104955514  Autophagy   Other autophagy associated proteins     104955514 Chromosome and associated proteins [BR:ncc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104955514 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104955514   Exosomal proteins of other body fluids (saliva and urine)    104955514   Exosomal proteins of colorectal cancer cells    104955514 GTP-binding proteins [BR:ncc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     104955514 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Tor_FN3_2nd Septin AAA_7 Motif Other DBs NCBI-GeneID:  104955514 NCBI-ProteinID:  XP_010781153 UniProt:  A0A6I9P289 LinkDB All DBs Position Unknown AA seq 180 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLG NKCDVNDKRQVSKDRGEKLALEYGIKFMETSAKANINVENVSSSFFCGYSFTAGSILTKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacttacgattacttgtttaaactacttttaatcggcgattcaggcgtcgga aagacctgtgtactattcagattttcagaagatgccttcaactctacgtttatctctact ataggtattgatttcaagatcagaacaatagaattagatggcaagaagatcaagctacag atatgggatacagcaggacaagagcggttcaggaccatcacgacagcctactacagagga gccatgggcatcatgttagtgtatgacataaccaatgagaagtcctttgaaaacatcaag aactggatacggaatatcgaagagcatgcttcagccgatgtggagaggatggtccttggg aacaaatgcgacgtcaacgacaagcgacaggtgtccaaagaccgaggggagaagctggcg ctcgagtacggtatcaagttcatggagacgagcgcaaaggcaaacatcaacgtggagaat gtgagctcaagctttttctgcggttattcattcacagctgggagtatcttaactaagaga tga

DBGET integrated database retrieval system