Notothenia coriiceps (black rockcod): 104958093 Help Entry 104958093         CDS       T04920                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc03082   ATP-dependent chromatin remodeling ncc04217   Necroptosis Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104958093  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104958093  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncc03036]     104958093   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104958093 Chromosome and associated proteins [BR:ncc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104958093 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104958093 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104958093 NCBI-ProteinID:  XP_010784103 UniProt:  A0A6I9PBA8 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRHLRKGNYAHRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAAKK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagagggaagaccggaggaaaggcccgagccaaggctaagacgcgctcctct cgtgccggtctccagttccccgtcggccgtgtccacaggcatctgaggaagggtaattac gcccatcgtgtcggtgccggagccccggtgtacctggccgctgtgctggagtacctgacc gctgagatcctggagctggctggaaacgccgcccgggacaacaagaagacccgtatcatc ccccgccacctgcagctcgccgtccgcaacgacgaggagctgaacaagctgctgggagga gtgaccatcgctcagggaggcgtgctgcccaacatccaggctgtgctgctgcccaagaag accgagaaagctgccaagaagtga

DBGET integrated database retrieval system