Notothenia coriiceps (black rockcod): 104960723 Help Entry 104960723         CDS       T04920                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc03082   ATP-dependent chromatin remodeling ncc04217   Necroptosis Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104960723  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104960723  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncc03036]     104960723   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104960723 Chromosome and associated proteins [BR:ncc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104960723 Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104960723 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104960723 NCBI-ProteinID:  XP_010787182 UniProt:  A0A6I9PG39 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search KTGGKARAKAKTRSSRAGLQFPVGRVHRHLRKGNYAQRVGAGAPVYLAAVLEYLTAEILE LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPA KK NT seq 370 nt NT seq  +upstreamnt  +downstreamnt caagaccggaggaaaagccagagcgaaggccaagactcgctcatcccgggccgggctcca gttccccgtcggccgtgtccacaggcatctgaggaagggtaactatgcccagcgtgtcgg tgccggagccccggtgtacctggccgctgtgctggagtacctgaccgctgagatcctgga gctggctggaaacgccgcccgggacaacaagaagacccgtatcatcccccgccacctgca gctcgccgtccgcaacgacgaggagctgaacaagctgctgggaggagtgaccatcgctca gggaggcgtgctgcccaacatccaggctgtgctgctgcccaagaagaccgagaagcccgc caagaagtga

DBGET integrated database retrieval system