Notothenia coriiceps (black rockcod): 104961913 Help Entry 104961913         CDS       T04920                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04010   MAPK signaling pathway ncc04068   FoxO signaling pathway ncc04081   Hormone signaling ncc04114   Oocyte meiosis ncc04140   Autophagy - animal ncc04150   mTOR signaling pathway ncc04810   Regulation of actin cytoskeleton ncc04910   Insulin signaling pathway ncc04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ncc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104961913 (ins)    04068 FoxO signaling pathway     104961913 (ins)    04150 mTOR signaling pathway     104961913 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     104961913 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104961913 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     104961913 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104961913 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104961913 (ins)    04914 Progesterone-mediated oocyte maturation     104961913 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ncc04052]     104961913 (ins) Cytokines and neuropeptides [BR:ncc04052]  Neuropeptides   Unclassified    104961913 (ins) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104961913 NCBI-ProteinID:  XP_010788574 UniProt:  A0A6I9PCN1 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MTALWLQSVSLLVLVLVSLPGSRAAPGPQHLCGSHLVDALYLVCGERGFFYNPKRDVNPL MGFLPPKAAGENEVAEFGFKDQMELMVKRGIVEQCCHQPCNIFDLQNYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgacggctctgtggctccagtccgtgtccctgctggttctggtgctggtctctctgccg ggctcccgggccgctccgggccctcagcacctgtgtgggtctcacctggtggacgccctg tacctggtctgtggggaacgaggcttcttctacaaccccaagagagacgtgaaccccctg atgggtttcctccccccgaaggcggctggagaaaacgaggtggcagagttcggcttcaag gaccagatggagctgatggtgaagcgcggcatcgtggagcagtgctgccaccagccctgc aacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system