Notothenia coriiceps (black rockcod): 104965621 Help Entry 104965621         CDS       T04920                                  Symbol brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04519   Cadherin signaling ncc04810   Regulation of actin cytoskeleton ncc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     104965621 (brk1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104965621 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104965621 (brk1) SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil ABC_tran_CTD LXG DUF5617 Motif Other DBs NCBI-GeneID:  104965621 NCBI-ProteinID:  XP_010792913 UniProt:  A0A6I9PZ10 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggccaggaagatccagtccagagagagattcaccaagattgggcgaatcgagag tacatagaagtgataacgagcagcataaaaaaaatcgccgacttccttaactcatttgat atgtcgtgtcgatcacgattggccaccctcaatgagaagctcacagcgttggaaaggagg attgaatacattgaggcgagagtgacgaaaggagagaccttgacctag

DBGET integrated database retrieval system