Notothenia coriiceps (black rockcod): 104966775 Help Entry 104966775         CDS       T04920                                  Symbol hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc03410   Base excision repair ncc04140   Autophagy - animal ncc04217   Necroptosis Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     104966775 (hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104966775 (hmgb1)   09143 Cell growth and death    04217 Necroptosis     104966775 (hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ncc03036]     104966775 (hmgb1)    03400 DNA repair and recombination proteins [BR:ncc03400]     104966775 (hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncc04147]     104966775 (hmgb1) Chromosome and associated proteins [BR:ncc03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     104966775 (hmgb1) DNA repair and recombination proteins [BR:ncc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      104966775 (hmgb1)    MMR (mismatch excision repair)     Other MMR factors      104966775 (hmgb1) Exosome [BR:ncc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104966775 (hmgb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Ribosomal_60s NOA36 Motif Other DBs NCBI-GeneID:  104966775 NCBI-ProteinID:  XP_010794363 UniProt:  A0A6I9Q255 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MVKVLGKPKGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSQKEKGKFE DLAKLDKVRYERDMQNYDPPAGQRKKRFKDPNAPKRPPSAFFLFCGDFRAKIKSEHPGLT IGDTAKKLGEMWNTSSAENKQPYERKGAKLKEKYDKDVLAYRTKGTVEAAAPPAAAAAAD DDDDDDDEDEEEDDDDDDDE NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggttttgggaaagccgaaaggcaaaatgtcctcatatgcctactttgtacaa acatgccgagaggagcataagaagaaacatcctgaagcctctgtcaacttctctgagttc tcaaagaaatgctctgagcgatggaagacaatgtcacagaaagagaagggcaagtttgaa gatttagccaaactagacaaggtgcgttatgagagggacatgcagaattacgatccccca gccggccagaggaagaagcgattcaaggaccccaatgcccccaagagaccaccgtctgca ttcttcctgttctgcggtgactttcgcgcaaagataaaaagcgagcaccctggacttact attggggacactgcaaagaagttgggagagatgtggaacacctcctctgcagagaacaaa cagccatacgagaggaagggagccaagttgaaggagaagtatgacaaggatgtccttgca taccgcacaaagggcacagttgaggccgcagcacctcctgcagcagcagcggcagcggac gacgacgatgatgatgatgacgaagatgaagaggaagatgatgatgatgacgatgatgag tag

DBGET integrated database retrieval system