Notothenia coriiceps (black rockcod): 104967960 Help Entry 104967960         CDS       T04920                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04621   NOD-like receptor signaling pathway ncc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ncc00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104967960 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104967960 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ncc03110]     104967960 (txn) Chaperones and folding catalysts [BR:ncc03110]  Protein folding catalysts   Protein disulfide isomerase    104967960 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 OST3_OST6 AhpC-TSA DIM1 Thioredoxin_7 Thioredoxin_8 Thioredoxin_9 A6-like_Thioredoxin-like_C Redoxin TXD17-like_Trx Motif Other DBs NCBI-GeneID:  104967960 NCBI-ProteinID:  XP_010795805 UniProt:  A0A6I9Q6I7 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MGVTNITNLEQFNKALKEAGDKLVVVDFTASWCGPCKKIGPVFKAQADLPENSNVVFLVV DVDVAADVSESCGIKAMPTFFYYKNEEKVDELTGANDAKLISKLASLRT NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgggggttaccaacatcaccaatctggagcagttcaataaggctctgaaggaagctgga gacaagctggtggtggtggacttcacagccagttggtgtggaccctgcaaaaagattggc ccagtatttaaggcacaggcggatcttcctgaaaactccaatgtggttttcttggtggta gacgtggatgttgctgcagatgtttctgaaagttgcggcatcaaagccatgcccacattc ttttattacaagaatgaagaaaaggtggatgagctcactggtgccaacgatgcaaaactg ataagcaaactggcctctttgaggacatag

DBGET integrated database retrieval system