Notothenia coriiceps (black rockcod): 104968327 Help Entry 104968327         CDS       T04920                                  Symbol josd1 Name (RefSeq) josephin-1   KO K15235   josephin [EC:3.4.19.12] Organism ncc  Notothenia coriiceps (black rockcod) Brite KEGG Orthology (KO) [BR:ncc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ncc01002]     104968327 (josd1)   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ncc04121]     104968327 (josd1) Enzymes [BR:ncc01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.19  Omega peptidases     3.4.19.12  ubiquitinyl hydrolase 1      104968327 (josd1) Peptidases and inhibitors [BR:ncc01002]  Cysteine peptidases   Family C86    104968327 (josd1) Ubiquitin system [BR:ncc04121]  Deubiquitinating enzyme (DUB)   Ubiquitin-specific proteases (UBPs)    MJD     104968327 (josd1) SSDB OrthologParalogGFIT Motif Pfam:  Josephin Motif Other DBs NCBI-GeneID:  104968327 NCBI-ProteinID:  XP_010796204 UniProt:  A0A6I9Q828 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MEIGLSPSTLVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIELSNVTGF ILNVPSNLRWGPLMLPLKRQHWMGVREVGGVYYNLDSKLRSPQPIGAPDHLR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggaaattgggctttctcccagcactctggtgacgccgcacaagaagagcatgctggga aacgggaactacgatgtaaacgtcatcatggcggcgctgcagacccgcgggttcgaggcc gtttggtgggataaaagaagggatgtgggcagcatcgagctgtccaacgtgacgggcttc atcctgaacgtcccgtccaacctgcgctggggtcctctgatgctgccgctcaaacgccag cactggatgggagtcagggaggtggggggggtctactacaacctggactccaagctgcgc agccctcagccaatcggagcgcccgaccacctcaggtag

DBGET integrated database retrieval system