Natranaerofaba carboxydovora: ACONDI_01274 Help Entry ACONDI_01274      CDS       T07970                                  Name (GenBank) 4Fe-4S dicluster domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ncd  Natranaerofaba carboxydovora Pathway ncd00020   Citrate cycle (TCA cycle) ncd00720   Other carbon fixation pathways ncd01100   Metabolic pathways ncd01110   Biosynthesis of secondary metabolites ncd01120   Microbial metabolism in diverse environments ncd01200   Carbon metabolism ncd01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ncd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ACONDI_01274   09102 Energy metabolism    00720 Other carbon fixation pathways     ACONDI_01274 Enzymes [BR:ncd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ACONDI_01274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_21 Fer4_2 Fer4_8 Fer4_6 Fer4_17 Fer4_3 Fer4_15 Fer4_22 Fer4_13 Motif Other DBs NCBI-ProteinID:  UMZ73709 LinkDB All DBs Position complement(1332629..1332847) Genome browser AA seq 72 aa AA seqDB search MDNDNISSVVIAGKWCKGCGICIEFCPKKVLDFDSKGKSYVKNPEDCNKCQQCELRCPDF AIVVKKGEKDNE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggataatgataatattagttcagtagttatcgcaggcaaatggtgcaaaggctgtgga atatgcatagaattttgtcccaagaaagtattagactttgattccaagggtaaatcttat gtcaaaaacccagaggattgtaataaatgtcaacaatgtgaacttcgctgcccggatttt gcgattgttgtaaaaaagggggagaaagataatgagtga

DBGET integrated database retrieval system