Vairimorpha ceranae: NCER_101420 Help Entry NCER_101420       CDS       T01614                                  Name (GenBank) hypothetical protein   KO K03357   anaphase-promoting complex subunit 10 Organism nce  Vairimorpha ceranae Pathway nce04111   Cell cycle - yeast nce04113   Meiosis - yeast nce04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nce00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NCER_101420  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     NCER_101420    04113 Meiosis - yeast     NCER_101420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nce04121]     NCER_101420    03036 Chromosome and associated proteins [BR:nce03036]     NCER_101420 Ubiquitin system [BR:nce04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      NCER_101420 Chromosome and associated proteins [BR:nce03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     NCER_101420 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANAPC10 Motif Other DBs NCBI-ProteinID:  EEQ81954 UniProt:  C4V9Z5 LinkDB All DBs AA seq 138 aa AA seqDB search MNIRLSSSKRDHGVKELLSSDLSEYWATDDSLPHGIQFTFCKLTYVEEVRIFLSHSQDDS YTPREIEVLCGLTESTIDSIILTSLLEPEGYIVFNVNKKCFFLQIIILSNHQEGKDSHIR NIKIMESKTKEMYLKVEQ NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaatataagactaagttcgtctaagagagatcatggagtaaaggaacttttatctagt gatcttagtgaatactgggctactgatgattcgcttccacatggcatacaatttacattt tgtaagcttacttatgttgaagaggttaggatttttctcagtcattcacaagacgacagt tacactcctagagagatagaagtcttatgcggacttacagaaagtacaattgattccata attttaacatctttgttagaaccagaaggatacattgtttttaatgtaaataagaaatgt ttctttttacaaattattattttgtcgaatcatcaagaaggaaaagattctcacatacga aatattaaaataatggaatctaaaacaaaagaaatgtatcttaaagtagaacaataa

DBGET integrated database retrieval system