Vairimorpha ceranae: NCER_102312 Help Entry NCER_102312       CDS       T01614                                  Name (GenBank) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism nce  Vairimorpha ceranae Pathway nce03020   RNA polymerase nce03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:nce00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NCER_102312   09124 Replication and repair    03420 Nucleotide excision repair     NCER_102312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:nce03021]     NCER_102312    03400 DNA repair and recombination proteins [BR:nce03400]     NCER_102312 Transcription machinery [BR:nce03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NCER_102312   RNA polymerase III system    RNA polymerase III      NCER_102312   RNA polymerase I system    RNA polymerase I      NCER_102312 DNA repair and recombination proteins [BR:nce03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NCER_102312 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-ProteinID:  EEQ81318 UniProt:  C4VBT4 LinkDB All DBs AA seq 74 aa AA seqDB search MLIPVRCFTCNKEISSKWEPYKYLINTDKSPADALNELDIKRICCRRMFLGHVEIIDKLI KYDVAKDIHFRNDF NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttaattccagttcgatgctttacatgcaataaagaaatttctagtaaatgggaacca tacaagtatcttataaatacagataaatctcctgcggatgcgttgaatgaattggatatt aagagaatttgctgtaggagaatgtttttaggacatgtagaaattattgataaattaata aaatatgatgtagcaaaagatattcattttagaaatgatttttaa

DBGET integrated database retrieval system