Nostoc cf. commune: ANSO36C_35520 Help Entry ANSO36C_35520     CDS       T10378                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ncf  Nostoc cf. commune Pathway ncf00998   Biosynthesis of various antibiotics ncf01100   Metabolic pathways ncf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ncf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ANSO36C_35520 (acpP)    00074 Mycolic acid biosynthesis     ANSO36C_35520 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ANSO36C_35520 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF6137 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BDI17750 LinkDB All DBs Position 3907385..3907639 Genome browser AA seq 84 aa AA seqDB search MSQTELFDKVKKIVAEQLSVDDVAKITPQSKFMDDLGADSLDTVELVMALEEEFDIEIPD EAAEQIISVQDAVDYINNKVAASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaaacggaactttttgataaggtcaaaaaaattgtcgccgaacaattgagtgtt gacgacgttgccaaaatcacaccccagtccaagtttatggacgatctaggagcagactct ttagataccgttgaattggtgatggctttggaagaagaatttgatatcgaaattcctgac gaagctgccgagcagattatatccgttcaagacgcagtagattacatcaataacaaagtt gccgcatcagcttaa

DBGET integrated database retrieval system