Neisseria canis: NCTC10296_00281 Help Entry NCTC10296_00281   CDS       T06799                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nci  Neisseria canis Pathway nci01100   Metabolic pathways nci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10296_00281 (acpP_1)    00074 Mycolic acid biosynthesis     NCTC10296_00281 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10296_00281 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  VEE99323 UniProt:  A0A1X3D0C2 LinkDB All DBs Position 1:291822..292058 Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVSEDEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYINAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacatcgaacaacaagttaaaaaaattgttgctgaacaactgggtgtaagcgaa gacgaagtgaaaaacgaatcttcattccaagacgatctgggcgcagactctttggatact gtagagctggttatggctttggaagaagctttcggctgcgaaattccagacgaagaagca gaaaaaatcactaccgtgcaactggcgattgattacattaacgcccacaacggctaa

DBGET integrated database retrieval system