Neisseria canis: NCTC10296_00915 Help Entry NCTC10296_00915   CDS       T06799                                  Symbol dmpI Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism nci  Neisseria canis Pathway nci00362   Benzoate degradation nci00621   Dioxin degradation nci00622   Xylene degradation nci01100   Metabolic pathways nci01120   Microbial metabolism in diverse environments nci01220   Degradation of aromatic compounds Module nci_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:nci00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NCTC10296_00915 (dmpI)    00622 Xylene degradation     NCTC10296_00915 (dmpI)    00621 Dioxin degradation     NCTC10296_00915 (dmpI) Enzymes [BR:nci01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      NCTC10296_00915 (dmpI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  VEF00557 UniProt:  A0A1X3CUI4 LinkDB All DBs Position 1:complement(993644..993835) Genome browser AA seq 63 aa AA seqDB search MPIIQVHMMEGRTDEQKEAVIREVTEAMIRAVGAPKESVRVLINEMPKQHFGIAGESAKA KGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccgattattcaagtccacatgatggaaggccgtaccgacgagcagaaagaagccgtt atccgcgaagtaaccgaagccatgatccgcgccgtgggtgcgcccaaagaatcggtgcgg gtgctgattaacgaaatgcccaagcagcatttcggtattgcaggagagtcggccaaagcc aaaggccgctga

DBGET integrated database retrieval system