Neisseria canis: NCTC10296_02198 Help Entry NCTC10296_02198   CDS       T06799                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nci  Neisseria canis Pathway nci01100   Metabolic pathways nci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10296_02198    00074 Mycolic acid biosynthesis     NCTC10296_02198   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10296_02198 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VEF03202 UniProt:  A0A1X3CWU8 LinkDB All DBs Position 1:complement(2305162..2305419) Genome browser AA seq 85 aa AA seqDB search MNLETQIKQMIIDSLGLEDITVNDIETDAPLFGDEGLGLDSVDALELGLAVQKTFGFQLD GEKDNLRDHFTSVATLAEFVRSRQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaatttagaaacacaaatcaaacagatgattatcgacagcttaggtctggaagacatt accgttaacgatattgaaaccgatgcgccgctgtttggcgacgaaggattgggtttggat tcggtggatgctttggagttgggtttggctgtgcaaaaaactttcggcttccagctcgac ggtgaaaaagacaatctgcgcgaccatttcaccagcgtagccacactggccgagtttgtc cgcagccgtcaagcataa

DBGET integrated database retrieval system