Neomoorella carbonis: MCACP_00550 Help Entry MCACP_00550       CDS       T11049                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ncj  Neomoorella carbonis Pathway ncj00020   Citrate cycle (TCA cycle) ncj00720   Other carbon fixation pathways ncj01100   Metabolic pathways ncj01110   Biosynthesis of secondary metabolites ncj01120   Microbial metabolism in diverse environments ncj01200   Carbon metabolism ncj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ncj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MCACP_00550   09102 Energy metabolism    00720 Other carbon fixation pathways     MCACP_00550 Enzymes [BR:ncj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MCACP_00550 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4 Fer4_16 Fer4_9 Fer4_6 LdpA_Fe-S-bd Fer4_10 Fer4_4 Fer4_2 Fer4_8 Fer4_22 Fer4_17 Fer4_3 Motif Other DBs NCBI-ProteinID:  WXJ93607 LinkDB All DBs Position 47913..48218 Genome browser AA seq 101 aa AA seqDB search MSVTFKAITTENGKGIFHLFPALCKGCGLCIEKCPVDTIGWAKQLGAFGTPVVEPGHGKP CIACKKCQLVCPDAAIWIERRDGKGRDTSLTAAPEKHVQHK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcgtcactttcaaagccattaccaccgagaatggcaaagggatcttccatctgttc ccggccctgtgcaagggctgcggcctctgcatcgagaagtgtcctgtagacaccatcggc tgggctaaacaactgggggccttcggcaccccggtggtagagccggggcacgggaaacca tgcattgcctgtaaaaaatgccagctggtctgccccgatgctgccatctggatcgaaagg cgcgacggcaagggccgggatactagcctgacagctgctccggaaaagcatgtccagcat aagtga

DBGET integrated database retrieval system