Nostocales cyanobacterium HT-58-2: BZZ01_13240 Help Entry BZZ01_13240       CDS       T04905                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ncn  Nostocales cyanobacterium HT-58-2 Pathway ncn00998   Biosynthesis of various antibiotics ncn01100   Metabolic pathways ncn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ncn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BZZ01_13240    00074 Mycolic acid biosynthesis     BZZ01_13240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BZZ01_13240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF6137 DUF5783 Ribosomal_L50 HLH DUF1493 Motif Other DBs NCBI-ProteinID:  ARV59463 UniProt:  A0A1Y0RHI8 LinkDB All DBs Position 3268590..3268841 Genome browser AA seq 83 aa AA seqDB search MSQAEIFEKVKKIVADQLSVDAETITPQSNFANDLGADSLDTVELVMALEEEFDVEIPDE AAEKITTVQEAVDYINNKVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcggaaatttttgaaaaggtcaagaaaatagttgctgatcaactgagtgtt gatgctgaaactatcacaccacaatctaattttgccaacgatttaggggctgactccctt gataccgttgaattggttatggctttggaagaagaatttgatgttgaaattcctgatgaa gccgccgaaaaaattacgacggttcaagaggcagtggattatatcaacaacaaagttgct gcatccgcctaa

DBGET integrated database retrieval system