KEGG   Nymphaea colorata (blue-petal water lily): 116248824
Entry
116248824         CDS       T07418                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
ncol  Nymphaea colorata (blue-petal water lily)
Pathway
ncol00220  Arginine biosynthesis
ncol00250  Alanine, aspartate and glutamate metabolism
ncol00270  Cysteine and methionine metabolism
ncol00330  Arginine and proline metabolism
ncol00350  Tyrosine metabolism
ncol00360  Phenylalanine metabolism
ncol00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncol00710  Carbon fixation by Calvin cycle
ncol00950  Isoquinoline alkaloid biosynthesis
ncol00960  Tropane, piperidine and pyridine alkaloid biosynthesis
ncol01100  Metabolic pathways
ncol01110  Biosynthesis of secondary metabolites
ncol01200  Carbon metabolism
ncol01210  2-Oxocarboxylic acid metabolism
ncol01230  Biosynthesis of amino acids
Module
ncol_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ncol_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ncol00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    116248824
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    116248824
   00270 Cysteine and methionine metabolism
    116248824
   00220 Arginine biosynthesis
    116248824
   00330 Arginine and proline metabolism
    116248824
   00350 Tyrosine metabolism
    116248824
   00360 Phenylalanine metabolism
    116248824
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    116248824
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    116248824
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    116248824
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncol01007]
    116248824
Enzymes [BR:ncol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     116248824
Amino acid related enzymes [BR:ncol01007]
 Aminotransferase (transaminase)
  Class I
   116248824
SSDB
Motif
Pfam: Aminotran_1_2 PaO Speriolin_C
Other DBs
NCBI-GeneID: 116248824
NCBI-ProteinID: XP_031477675
LinkDB
Position
2:complement(15947302..15953119)
AA seq 417 aa
MAAFMVRKRWFSGSSIDWWDGVKPAAKDPIFAITEAFLADDCPSKINLGVGTYRDEKGRP
VILECVRRAEAKIGGVQTMEYLPIGGDPKLVQETIKLAYGENSDAVKENRVAGIQALSGT
GSCRLFAEFQRRFRPESPMYLPIPTWSNHHNIWRDAHVTQRTFHYYHHQSKGLDFGKLME
DVKNAPDSSFFLFHACAHNPTGVDPSEEQWKEISHLFKVKKHFPFFDVAYQGFASGDPEK
DARAIRIFLEDGHKIACAHSFSKIMGLYGLRVGCLSIVCKDAEQSAAVKSQLQQIARPIY
SNPPVHGALLVYTILTDPDLRSLWLAELKVMVSRINVMRNLLRKSIENFGSLHNWEHITN
QIGMFCYTGLSPEQVDRLVNEFHIYMTRSGRISMAGITPASVDYLAKAIHEVTKHDR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcagcattcatggtgaggaaaagatggttttctggttcatcaatcgactggtgggac
ggcgtgaaaccggctgcaaaagatcccatcttcgcaatcactgaagcgttcctcgccgat
gactgccctagcaagatcaacctcggtgtgggaacgtatcgtgacgagaaggggaggcct
gtgattcttgaatgtgtacgcagagcagaggcgaaaatcggtggcgttcaaaccatggaa
tatctcccgattggaggtgacccgaaattggttcaggaaaccattaaactagcgtatggg
gaaaactctgatgcggtgaaggagaacagagtggctggaatccaagctctttcaggcacc
ggatcatgccggctttttgccgagttccagcgacggttcaggccggaatcgcccatgtac
ctccccatcccgacttggtcgaaccatcataacatttggagggacgcacacgttacacag
agaactttccactactatcatcatcaatctaaaggattagactttgggaagcttatggaa
gatgttaagaatgctccagattcttcctttttcttgttccatgcatgcgctcacaaccca
accggagttgatccttccgaggagcagtggaaagaaatctcacatttatttaaggtaaag
aaacactttcccttctttgacgtggcttaccaaggctttgcaagcggagaccctgaaaaa
gatgctcgagcaattcgaatatttctggaagatggccataaaattgcatgtgctcactcc
ttttcgaagatcatgggactatatggccttagagtgggatgcttaagcattgtgtgcaag
gatgccgaacaatcagctgctgtcaagagccaattgcagcaaatagcgaggcccatctat
agtaacccgcctgttcatggtgcacttcttgtatatacaattctcaccgacccagattta
aggagcctttggcttgcagagttaaaggttatggtcagtcgcatcaatgtaatgcggaat
ttgttgcgtaaaagcatcgagaactttggatcccttcacaactgggagcatattacaaat
cagattggtatgttttgctatactggtttgtcccctgagcaggtcgaccgcctagttaat
gaattccacatatatatgaccaggagtggtcgaatcagtatggctggaatcacacctgca
agtgtggattacttggcaaaagccatccatgaagttacaaagcatgacagatag

DBGET integrated database retrieval system