Neurospora crassa: NCU02160 Help Entry NCU02160          CDS       T01034                                  Symbol rac-1 Name (RefSeq) Rac1 homolog-1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ncr  Neurospora crassa Pathway ncr04145   Phagosome ncr04148   Efferocytosis ncr04620   Toll-like receptor signaling pathway ncr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ncr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     NCU02160 (rac-1)    04148 Efferocytosis     NCU02160 (rac-1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     NCU02160 (rac-1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     NCU02160 (rac-1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncr04131]     NCU02160 (rac-1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncr04147]     NCU02160 (rac-1)    04031 GTP-binding proteins [BR:ncr04031]     NCU02160 (rac-1) Membrane trafficking [BR:ncr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     NCU02160 (rac-1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     NCU02160 (rac-1)   Macropinocytosis    Ras GTPases     NCU02160 (rac-1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     NCU02160 (rac-1) Exosome [BR:ncr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NCU02160 (rac-1)   Exosomal proteins of other body fluids (saliva and urine)    NCU02160 (rac-1)   Exosomal proteins of colorectal cancer cells    NCU02160 (rac-1)   Exosomal proteins of bladder cancer cells    NCU02160 (rac-1) GTP-binding proteins [BR:ncr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     NCU02160 (rac-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  3880671 NCBI-ProteinID:  XP_964519 UniProt:  Q7RW05 LinkDB All DBs Position I:1048323..1050458 Genome browser AA seq 200 aa AA seqDB search MAAIGGVQSIKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPVSLG LWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPPSFDNVKSKWHPEIQHHAPGIPIILVG TKLDLREDPDTIQSLSQKRMAPITFEMGVNCAKEIGARKYLECSALTQRNLKSVFDEAIR AVLYRVDTTQEKKKSKCTIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggctgctatcggaggcgtgcagtcgatcaagtgcgtcgtcactggtgacggtgctgta ggaaagacatgtcttctcatctcatacacaacaaatgccttccccggcgaatacattccc acagtcttcgataattactcggcgagtgttatggtcgatggcaagcccgtgagcttgggt ctctgggatactgctggacaggaggattacgacagactgcgcccgctttcgtacccccag accgacgtcttcctcatctgcttttcgctcgtcagccctccgtcgttcgacaacgtcaag tccaagtggcaccccgagatccagcatcacgcccccggcatccccatcatcttggtgggc accaagctcgatttgcgcgaggaccccgataccattcagagcctgagccagaaacgcatg gctccgataacgttcgagatgggtgtcaactgcgccaaggagatcggcgcgaggaagtac ctcgagtgctctgcccttacccaaaggaatctcaagtctgttttcgacgaggccatcaga gctgtgctctaccgcgtcgatacgacccaagaaaagaagaagtccaagtgcactatcctc taa

DBGET integrated database retrieval system