Neurospora crassa: NCU04120 Help Entry NCU04120          CDS       T01034                                  Symbol cmd Name (RefSeq) calmodulin A   KO K02183   calmodulin Organism ncr  Neurospora crassa Pathway ncr04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:ncr00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     NCU04120 (cmd)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ncr01009]     NCU04120 (cmd)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncr04131]     NCU04120 (cmd)    03036 Chromosome and associated proteins [BR:ncr03036]     NCU04120 (cmd)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncr04147]     NCU04120 (cmd) Protein phosphatases and associated proteins [BR:ncr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      NCU04120 (cmd) Membrane trafficking [BR:ncr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     NCU04120 (cmd) Chromosome and associated proteins [BR:ncr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      NCU04120 (cmd) Exosome [BR:ncr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    NCU04120 (cmd) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg UPF0154 EFhand_Ca_insen EF_EFCAB10_C TerB EF-hand_11 RNA_pol_Rpb4 Caleosin Dockerin_1 DUF5580_M FCaBP_EF-hand SPEF2_C SurA_N_2 MTIP_N Poly_export Motif Other DBs NCBI-GeneID:  3877440 NCBI-ProteinID:  XP_961276 UniProt:  P61859 LinkDB All DBs Position V:4911110..4913296 Genome browser AA seq 149 aa AA seqDB search MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN NGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDD EVDEMIREADQDGDGRIDYNEFVQLMMQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggactcccttactgaagagcaggtctctgagttcaaggaggccttctcccttttt gacaaggacggtgatggccaaatcaccaccaaggagctcggtaccgtcatgcgctcgttg ggccagaacccctccgagtctgagcttcaggacatgatcaacgaggtcgatgccgacaac aacggcaccattgacttccctgagttccttaccatgatggccagaaagatgaaggatacc gactccgaggaggagatccgtgaggccttcaaggtgttcgatcgcgacaacaacggcttc atctccgctgccgagctccgtcacgtcatgacctccatcggcgagaagctcactgatgac gaggttgatgagatgatccgtgaggccgaccaggacggcgatgggcgtatcgactacaac gagttcgtccagctcatgatgcagaagtaa

DBGET integrated database retrieval system