Neurospora crassa: NCU06454 Help Entry NCU06454          CDS       T01034                                  Symbol cdc42 Name (RefSeq) cell division cycle 42-like   KO K04393   cell division control protein 42 Organism ncr  Neurospora crassa Pathway ncr04011   MAPK signaling pathway - yeast ncr04144   Endocytosis ncr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ncr00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     NCU06454 (cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     NCU06454 (cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     NCU06454 (cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncr04131]     NCU06454 (cdc42)    03036 Chromosome and associated proteins [BR:ncr03036]     NCU06454 (cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ncr04147]     NCU06454 (cdc42)    04031 GTP-binding proteins [BR:ncr04031]     NCU06454 (cdc42) Membrane trafficking [BR:ncr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     NCU06454 (cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     NCU06454 (cdc42)   Macropinocytosis    Ras GTPases     NCU06454 (cdc42) Chromosome and associated proteins [BR:ncr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     NCU06454 (cdc42) Exosome [BR:ncr04147]  Exosomal proteins   Exosomal proteins of microglial cells    NCU06454 (cdc42)   Exosomal proteins of breast milk    NCU06454 (cdc42) GTP-binding proteins [BR:ncr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     NCU06454 (cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU KELK Motif Other DBs NCBI-GeneID:  3873514 NCBI-ProteinID:  XP_011393920 UniProt:  U9W2S4 LinkDB All DBs Position III:complement(1462668..1465414) Genome browser AA seq 196 aa AA seqDB search MVTGTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLICFSVASPASFENVSQKWAPEVNHHCPGVPFLIVGTQKD LRSDKELRDKLAQRKQSMIEFKQGEKLAQDLDAVKYVECSALTQEGLKNVFDEAIVAALE PPQKKTSKRDKKCLIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggtgacgggaactatcaagtgcgtagtcgtcggtgacggtgccgttggaaagacatgt ctcctcatcagctatacaacgaataagttcccctcggaatatgtgccgacagttttcgac aactatgccgtcaccgtcatgatcggtgatgagccctatacgctcggcctgttcgataca gcaggacaagaagattacgaccgtttacgtccgctatcatacccccagaccgacgtcttc ctcatctgcttcagcgttgcatcgcccgcctcgttcgaaaacgtgtcccagaaatgggcc cccgaagtcaaccatcactgccccggcgtgcccttcctcatcgtcggaacgcagaaggat ttgcgctccgacaaggaactgagggacaagcttgcccagcgcaagcagtcgatgatagag ttcaagcagggagagaagcttgctcaggatcttgacgccgtcaaatacgtcgagtgcagt gcgctgacacaggaaggtctcaagaacgtgtttgacgaggccatcgttgcggcactggag ccgcctcagaaaaagacaagtaaaagggacaagaagtgcttgattctgtga

DBGET integrated database retrieval system