KEGG   Naumovozyma castellii: NCAS_0B01800
Entry
NCAS_0B01800      CDS       T02233                                 
Symbol
NCAS0B01800
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
ncs  Naumovozyma castellii
Pathway
ncs04111  Cell cycle - yeast
ncs04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0B01800 (NCAS0B01800)
   04113 Meiosis - yeast
    NCAS_0B01800 (NCAS0B01800)
SSDB
Motif
Pfam: Fungal_TACC Crescentin GIT_CC DUF3764
Other DBs
NCBI-GeneID: 11525221
NCBI-ProteinID: XP_003674638
UniProt: G0VBD8
LinkDB
Position
2:complement(296677..299052)
AA seq 791 aa
MDSMDQEQYPQTPVRQAIGNYEQVIQPEPDTPSNMDNNDSSELVIHPHGLSSNKGDVSII
HLRSNEEEERRYDMSPDFNRGNNREGNALQSGNSLEALDINKMFQANTDDQGNLVEPKLA
HSPIRLEDISPMKLENNDSEHIKKKLRLDAESVPNLTRNDNNNSHNNNNNNNNNNNNINE
GETSPIPIEMIDMKISPIKSSISPIQRTPPSHHKRKRDDETDVENEEGRESSVHKLTPLY
DPDNNSNGEEDGDKDDLELTIDIENNEFRELKMRNNDVIKDNYQLHKKLNEFVIKFEKVK
VNYVAVKKEYDNLRNTFENEVNERESTIKEITQERDDLTEKRDKLKAKIKNSKDEILMLN
QNQKILQEKYDNLSNENDTWRNNYETLELEISKQKESHAIELNETSTKLETLKSELAESM
AKSQSLTEKNNDMHEELDTIQQSLQTKNELISSLEATIKEQQNTQDLTKENEKYREQFES
LFKEKDELTNKFNAMNEEYLTKIEEYQQKVIEAETELINIREKYNAVTVELEAKNGSMAS
LKKTSEELDDANKIKAAEVTELNDDLAEIKETNEYLEKSVSKLEKVVSEWKVKYETLQSD
YDKASLELESFQLKNDNIETEHLKELEDLHESMSSLQSALKDNSDLVHTLKIENETLKSD
LSRNEQMLKTATLEKDNKIVSIETEGTDKEQTIISLKKQLDEWKQKYDSKENETNKRLKL
LAEDLYIQYSSKHEQKVKLLKKGYESKYQGEISRLETQHMGLTQEVEQLTKQLEAEREEK
RNLLNMLENKN
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggacagcatggaccaagaacaatatccacagacccccgtaaggcaagctattggaaat
tatgagcaagttatacaaccggagccagacacacccagcaatatggacaataatgattcc
tccgagcttgtcattcaccctcatggattatcctcgaataaaggagatgtgtccatcatt
catctaaggtccaacgaagaagaagaaagaagatatgatatgtctccagactttaataga
ggaaataacagagagggtaatgctcttcagtctggtaatagcctagaagctcttgacatt
aacaaaatgttccaagccaatactgacgatcaaggtaacctcgtggaaccgaaattggct
cattcaccgattaggttggaagatatttcacctatgaaattggaaaacaatgacagcgag
catataaagaagaaattgagattagatgctgaatctgtcccaaatttgacaagaaatgat
aataataatagtcataataataataataataataataataataataataatataaatgaa
ggtgagacgtcgcctattccaattgaaatgattgatatgaagataagtccaataaaatct
tctatctcgccgatacaaagaacgcctcccagtcatcataagcgcaaacgagatgatgag
acagatgtagagaacgaagaaggccgtgaatctagcgtacataaattgacaccactttat
gatccagacaataactcaaatggtgaagaagatggtgataaagatgatttagagctcaca
attgatatcgaaaataatgaatttagggaattgaaaatgcgtaataacgatgtgattaag
gataattatcaattacataaaaaattgaacgaatttgtcataaaatttgagaaagtgaaa
gtcaactacgtggctgttaaaaaagaatatgataatttacggaacacttttgaaaatgag
gtaaacgaacgtgagtcaaccatcaaagaaatcactcaagaacgtgatgacttaactgaa
aagagagataagttgaaagctaagataaaaaattccaaagatgaaatcttaatgctgaat
caaaatcaaaaaattcttcaggagaagtacgataatctgtccaatgaaaatgatacatgg
agaaataactatgaaactttggaattagaaattagtaaacaaaaagaaagtcatgccatc
gaattgaatgaaacatcaaccaaattggaaacattgaaatctgagcttgctgaaagtatg
gccaaatctcagagtttaaccgagaaaaacaatgatatgcatgaagagttagacaccatc
caacaatcgttacaaaccaaaaacgaattaatatcgtcattggaagcaacaataaaggaa
caacaaaatacccaagacttgacgaaggagaatgaaaaatatagggagcaatttgaaagt
ttatttaaagaaaaagatgaattgacgaataaatttaacgccatgaatgaagaataccta
actaagattgaggaatatcaacaaaaagttatagaggcagaaactgaacttataaatatt
agagagaaatataatgcagtcacagtggagttggaagcgaaaaatggttcgatggcttca
ttaaaaaagacatctgaagaattagatgatgctaataaaataaaagctgcagaagttact
gaattgaatgatgacttagccgaaattaaagaaactaatgagtatttggaaaaatctgtc
tccaaattggaaaaggtcgtcagtgaatggaaagtaaaatatgaaacgttacaatcagat
tatgacaaggcatccttagaattggaaagcttccagttaaagaatgataatattgaaact
gagcatttaaaggagttggaagatttacacgaaagtatgagttcattacagagtgcatta
aaggataattctgacttagtgcatacattgaaaatagaaaatgaaacattgaagtccgac
ctttcacgaaatgaacagatgttaaaaacagcaaccctggaaaaagataacaagatagta
tcaattgaaaccgaaggcacagataaagagcaaacaattatatctttaaagaaacaactg
gacgaatggaaacagaaatatgatagtaaagaaaacgaaaccaataagaggttgaagctg
ttggcagaagatctctatattcaatattcgtccaaacatgagcagaaagttaaacttctg
aaaaaaggttacgaaagtaaatatcaaggagagatttcaagacttgaaacacagcatatg
ggattaacgcaagaggtagaacaattaaccaaacagttagaagccgaacgagaggagaaa
aggaatctgctcaatatgttggaaaataaaaactaa

DBGET integrated database retrieval system