Naumovozyma castellii: NCAS_0B04080 Help Entry NCAS_0B04080      CDS       T02233                                  Symbol NCAS0B04080 Name (RefSeq) translocon subunit SSS1   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism ncs  Naumovozyma castellii Pathway ncs03060   Protein export ncs04141   Protein processing in endoplasmic reticulum ncs04145   Phagosome Brite KEGG Orthology (KO) [BR:ncs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     NCAS_0B04080 (NCAS0B04080)    04141 Protein processing in endoplasmic reticulum     NCAS_0B04080 (NCAS0B04080)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     NCAS_0B04080 (NCAS0B04080)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ncs04131]     NCAS_0B04080 (NCAS0B04080)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ncs02044]     NCAS_0B04080 (NCAS0B04080) Membrane trafficking [BR:ncs04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     NCAS_0B04080 (NCAS0B04080) Secretion system [BR:ncs02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    NCAS_0B04080 (NCAS0B04080) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE ASFV_p27 Motif Other DBs NCBI-GeneID:  96902051 NCBI-ProteinID:  XP_003674865 UniProt:  G0VA07 LinkDB All DBs Position 2:739044..739262 Genome browser AA seq 72 aa AA seqDB search MANEKSDNQIEKLMDAPLEFVKDGNQFLNKCKKPDLKEYTRIVRAVGIGFVAVGIIGYAI KLIHIPIRYVIV NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctaacgaaaaatcagacaaccaaatcgaaaagctaatggacgccccattagaattc gtcaaggatggtaaccaatttctaaacaagtgtaagaagcctgatttgaaagaatacacc agaattgtcagagctgtcggtatcggttttgttgctgtcggtatcattggttatgctatc aaattgatccatatcccaatcagatatgtcattgtctaa

DBGET integrated database retrieval system