Naumovozyma castellii: NCAS_0B04150 Help Entry NCAS_0B04150      CDS       T02233                                  Symbol NCAS0B04150 Name (RefSeq) TFIIH complex subunit TFB5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism ncs  Naumovozyma castellii Pathway ncs03022   Basal transcription factors ncs03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ncs00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     NCAS_0B04150 (NCAS0B04150)   09124 Replication and repair    03420 Nucleotide excision repair     NCAS_0B04150 (NCAS0B04150)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ncs03021]     NCAS_0B04150 (NCAS0B04150)    03400 DNA repair and recombination proteins [BR:ncs03400]     NCAS_0B04150 (NCAS0B04150) Transcription machinery [BR:ncs03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      NCAS_0B04150 (NCAS0B04150) DNA repair and recombination proteins [BR:ncs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      NCAS_0B04150 (NCAS0B04150) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 YokU Motif Other DBs NCBI-GeneID:  96902058 NCBI-ProteinID:  XP_003674872 UniProt:  G0VA14 LinkDB All DBs Position 2:751298..751516 Genome browser AA seq 72 aa AA seqDB search MPRARRGVLVQCDPSIKALIVQIDAQRSDIILEELDDTHLLVDPSKVDFIKQELNRLLSK NIYNAMDEEENQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgccaagagctagaagaggcgtactagtacaatgtgatccttcgatcaaagctcttatt gtacaaatcgatgctcaacgaagtgatatcatactggaagaactggacgatactcatctt ctggtggatccatccaaagtggactttataaaacaagaacttaacaggctgctttccaag aatatatataatgcaatggatgaagaggaaaatcaataa

DBGET integrated database retrieval system