Naumovozyma castellii: NCAS_0B07110 Help Entry NCAS_0B07110      CDS       T02233                                  Symbol NCAS0B07110 Name (RefSeq) Sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism ncs  Naumovozyma castellii Pathway ncs03018   RNA degradation ncs03040   Spliceosome Brite KEGG Orthology (KO) [BR:ncs00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     NCAS_0B07110 (NCAS0B07110)   09123 Folding, sorting and degradation    03018 RNA degradation     NCAS_0B07110 (NCAS0B07110)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ncs03019]     NCAS_0B07110 (NCAS0B07110)    03041 Spliceosome [BR:ncs03041]     NCAS_0B07110 (NCAS0B07110) Messenger RNA biogenesis [BR:ncs03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      NCAS_0B07110 (NCAS0B07110)   mRNA degradation factors    5'-3' decay     Lsm complex      NCAS_0B07110 (NCAS0B07110) Spliceosome [BR:ncs03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     NCAS_0B07110 (NCAS0B07110) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  96902352 NCBI-ProteinID:  XP_003675166 UniProt:  G0VA65 LinkDB All DBs Position 2:1351925..1352152 Genome browser AA seq 75 aa AA seqDB search MGGKLVSGTLKGYDQLMNLVLDDTIEYLKDADADIATSTVKDKTRELGFTVIRGPMLISL SPLDGSEVIYIQNSE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggcgggaaattggtttcgggtacactaaagggttatgaccaattgatgaatttagtc cttgatgatacgattgagtatttgaaagatgcagatgctgatattgcaacatcaactgtc aaggataagacgagagaattaggatttacagttattagaggtccaatgttgatctctttg agtccattagatggctccgaagtcatctatattcaaaattcagagtaa

DBGET integrated database retrieval system