Naumovozyma castellii: NCAS_0G01540 Help Entry NCAS_0G01540      CDS       T02233                                  Symbol NCAS0G01540 Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism ncs  Naumovozyma castellii Pathway ncs00510   N-Glycan biosynthesis ncs00513   Various types of N-glycan biosynthesis ncs01100   Metabolic pathways ncs04141   Protein processing in endoplasmic reticulum Module ncs_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ncs00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     NCAS_0G01540 (NCAS0G01540)    00513 Various types of N-glycan biosynthesis     NCAS_0G01540 (NCAS0G01540)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     NCAS_0G01540 (NCAS0G01540) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  11528531 NCBI-ProteinID:  XP_003677394 UniProt:  G0VI07 LinkDB All DBs Position 7:276294..276407 Genome browser AA seq 37 aa AA seqDB search MISDMQLNAMALGFGFLMVTLIVCYHAVDSTFVKKLK NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgatatcggacatgcaattaaatgccatggctcttggcttcggatttttgatggttaca ttgatcgtctgttatcatgcagtcgattccaccttcgtcaaaaagttgaaataa

DBGET integrated database retrieval system