KEGG   Naumovozyma castellii: NCAS_0G03200
Entry
NCAS_0G03200      CDS       T02233                                 
Symbol
NCAS0G03200
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
ncs  Naumovozyma castellii
Pathway
ncs04111  Cell cycle - yeast
ncs04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0G03200 (NCAS0G03200)
   04113 Meiosis - yeast
    NCAS_0G03200 (NCAS0G03200)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ncs03400]
    NCAS_0G03200 (NCAS0G03200)
DNA repair and recombination proteins [BR:ncs03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    NCAS_0G03200 (NCAS0G03200)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 11528702
NCBI-ProteinID: XP_003677559
UniProt: G0VIH2
LinkDB
Position
7:587423..589216
AA seq 597 aa
MSFRATITNIEKHTLWYRTIYILSTINDEIKLSITNAGLLAWTMNETETSLSQIFFSRSF
FDQFEYKPHDIVFGEDGVQVHKDFRGIDQKLYSFQMNAKHLTTISKKPENDTVKSFTIVL
NNTATCPETLTNRLLIQIEMESLILKEYAPLFTPIKFDPIIIDLKYKRKFLDVFGTAAES
PNPDQPLDPRLLDVYKRTEQELERSLFNDEVESSIRQKDKLTMADEINYICCNQILLRNI
IENYNSSVTTEIKLDIGAHKLNITAFTKAIFGEHDILVKNAMSICNTINTSDLEHYCLFT
SVDETQLANANIKKNDYTKSIIFKLKDLRNFMNIGSSLKVNPSDDDVISIWFCKPGDPIL
IETNRMGVRMQLVQITDSVTNTEYPVDGTKRITSPIKQARLQQEEAVFPEKAKKYSPSRS
KRYANRSEASPQKDNRRQLFVEADSQVEKSSNNIFAPVYEHMDTYEENKLPIFNNPEDPS
IARVNISRKRISSQEDGNSDVFHNKFAKDVSDNAANRSNTTIGWGKNQLDHLAYVKDGTR
NTIDSDSLLRREKQKLLPQENYDTDEHPDRREQIHDKSQEQSEFGPTQEKRPKGLFD
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtcattcagagcaaccattacaaatattgaaaaacatactctgtggtatcgtacaatc
tatatcttatccaccattaatgatgaaataaaactatccattaccaatgccgggctttta
gcatggacaatgaatgaaacagagacatctctgagccaaatcttcttttcaaggagcttc
tttgatcaatttgaatataaaccacatgatatcgtttttggagaggatggtgtccaagtt
cataaagattttcggggtattgatcagaaactatattcctttcaaatgaatgccaagcat
ttaacaacaatatcaaaaaaacctgagaacgataccgttaagtcatttaccattgtttta
aacaatacagccacatgtcctgaaactttgacgaatcgattattaatacagatcgaaatg
gaatcactaattttgaaagaatatgcaccactatttacacctattaagtttgatcctatt
attattgatttgaaatacaaacgtaagttccttgacgtctttgggacagcagctgaatca
cctaaccctgaccaacccttagacccgcgccttttagatgtttataagaggacagagcaa
gaattagagagatccctattcaatgatgaggtagagtctagcatccgacaaaaggataag
cttaccatggctgatgaaatcaactatatttgttgcaaccagattctcttacggaatatt
atcgagaattataattcctctgtaacaacagaaataaaacttgacatcggtgctcataaa
ttgaatataactgcatttacaaaagcgatttttggtgaacacgatattttggtaaagaat
gccatgagtatctgcaacacaataaatacctcagacctggaacattattgtttatttact
agtgttgatgagacccaactagccaacgccaacattaaaaagaatgactacactaaaagc
atcattttcaagctcaaggatctcagaaactttatgaatattgggtcatcactaaaggtg
aacccaagcgatgacgatgtaataagtatatggttctgtaaacctggtgatccaatttta
attgaaacaaacaggatgggcgttcgaatgcagttagtccaaatcactgacagtgtgaca
aatactgaataccccgtagatggaacgaaaaggataacatcacccatcaaacaagcaagg
ttgcagcaggaagaggctgtatttccagaaaaggcaaaaaaatatagcccttccagatcc
aaaagatatgcgaataggagtgaagcttctcctcaaaaggataataggaggcaactattt
gttgaggctgattcacaagtcgagaaatcatctaataatattttcgcaccagtatatgaa
catatggatacctacgaagaaaataaattacctattttcaacaacccagaggatccttct
attgctcgagttaacatttccaggaaaagaataagctctcaagaagatggaaattccgat
gttttccataataagtttgctaaagacgtttctgataatgctgcaaaccgaagcaataca
actattggttgggggaagaaccaactagatcacttagcgtacgttaaggatggaactaga
aacactatagatagtgatagtcttttgagaagagaaaagcagaaattgcttccacaggaa
aattatgacaccgatgaacatccagatagacgggaacaaattcatgataaatctcaagag
caaagtgaatttggaccaactcaagaaaaaagacccaagggtttgtttgactaa

DBGET integrated database retrieval system