Nostoc carneum: NIES2107_46850 Help Entry NIES2107_46850    CDS       T10358                                  Name (GenBank) hypothetical protein   KO K03666   host factor-I protein Organism ncw  Nostoc carneum Pathway ncw02024   Quorum sensing ncw03018   RNA degradation Brite KEGG Orthology (KO) [BR:ncw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NIES2107_46850  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NIES2107_46850  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ncw03019]     NIES2107_46850    03036 Chromosome and associated proteins [BR:ncw03036]     NIES2107_46850 Messenger RNA biogenesis [BR:ncw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NIES2107_46850 Chromosome and associated proteins [BR:ncw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NIES2107_46850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  BAY32791 LinkDB All DBs Position complement(5742921..5743157) Genome browser AA seq 78 aa AA seqDB search MHTSPAKTLTEFDTSLPSIRQVQNLIKNAAAVDFKLVTGDLLTGRIIWQDPNCVCIVDEN SQQTTLWKHAIAYIKPKI NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcatacatcaccagcaaaaacgcttacagaattcgacacttcactgcccagtattcgg caagtacaaaacctgattaaaaatgcagcagcagtagatttcaaactagtgacgggcgat ttacttacaggtaggataatttggcaagatccaaactgcgtctgtattgtggatgaaaac agtcagcaaactacactttggaagcacgcgatcgcttacattaagcctaaaatttag

DBGET integrated database retrieval system