Nonomuraea coxensis: Nocox_33760 Help Entry Nocox_33760       CDS       T07466                                  Symbol rpiB2 Name (GenBank) Ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ncx  Nonomuraea coxensis Pathway ncx00030   Pentose phosphate pathway ncx00051   Fructose and mannose metabolism ncx00710   Carbon fixation by Calvin cycle ncx01100   Metabolic pathways ncx01110   Biosynthesis of secondary metabolites ncx01120   Microbial metabolism in diverse environments ncx01200   Carbon metabolism ncx01230   Biosynthesis of amino acids Module ncx_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ncx_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ncx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     Nocox_33760 (rpiB2)    00051 Fructose and mannose metabolism     Nocox_33760 (rpiB2)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     Nocox_33760 (rpiB2) Enzymes [BR:ncx01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      Nocox_33760 (rpiB2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  QYC44319 LinkDB All DBs Position 7238008..7238442 Genome browser AA seq 144 aa AA seqDB search MRISVAADSKDGVAERVVTELRRRGHEVVTHGALHDGERDDWAWACELAARDVAEGRAEQ AVVCCWTGTGASIAANKVPGVRAALCVDAYTAGGARKWNDANVLALSLRLTSEVVLGEIL DAWLAGRPSDDPADLANISHLEQK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgcggatttctgtggcggccgacagcaaggacggcgtggccgagcgggtggtgaccgag ctgcggaggcgcggccacgaggtcgtcacgcacggcgcgctccacgacggcgagcgcgac gactgggcgtgggcctgcgagctggccgcccgcgacgtcgcagagggccgcgccgaacag gcggtcgtgtgctgctggaccggcaccggcgcctcgatcgccgcgaacaaggtccccggc gtgcgcgccgccctctgcgtcgacgcctacaccgccggcggggcccgcaagtggaacgac gccaacgtgctcgccctgagcctgcgcctgacctccgaggtggtgctcggcgagatcctg gacgcctggctcgccggacggcccagcgacgaccccgccgacctggccaacatctcccac ctggagcagaagtga

DBGET integrated database retrieval system