Neisseria cinerea: NCTC10294_01520
Help
Entry
NCTC10294_01520 CDS
T06828
Symbol
nuoJ
Name
(GenBank) protein NuoJ
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
ncz
Neisseria cinerea
Pathway
ncz00190
Oxidative phosphorylation
ncz01100
Metabolic pathways
Module
ncz_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
ncz00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
NCTC10294_01520 (nuoJ)
Enzymes [BR:
ncz01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
NCTC10294_01520 (nuoJ)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
DUF2109
DUF3397
DUF6350
Motif
Other DBs
NCBI-ProteinID:
SQF84033
LinkDB
All DBs
Position
1:complement(1546457..1547128)
Genome browser
AA seq
223 aa
AA seq
DB search
MTFSAILFYILAAIVLYGAVRTVTAKNPVHAALHLVLTFCVSAMLWMLMQAEFLGVTLVV
VYVGAVMVLFLFVVMMLNIDIEEMRAGFWRHAPVAGVVGTLLAVALILILVNPKTDLAAF
GLMKDIPADYNNIRDLGSRIYTDYLLPFELAAVLLLLGMVAAIALVHRKTVNPKRMDPAD
QVKVRADQGRMRLVKMEAVKPQVESDEESEVSDGLKPEGEGKA
NT seq
672 nt
NT seq
+upstream
nt +downstream
nt
atgactttttccgcgattctgttctatattcttgccgctatcgttttgtacggtgcggtt
cgtaccgtcactgctaaaaaccccgttcacgccgctttgcatctggtgctgaccttctgc
gtgagtgcgatgctttggatgctgatgcaggctgaattcttgggcgtgacgctggtggtg
gtttacgtcggcgccgtgatggtgttgttcctgttcgtcgtgatgatgttgaacatcgac
attgaagaaatgcgcgccggtttctggcgtcatgcgccggttgccggtgtggtcggcaca
ttgttggcggttgccctgatcctgattctggtcaacccgaaaaccgatctggccgcattt
ggtctgatgaaagacattccggccgattacaacaatatccgcgatttgggcagccgtatt
tataccgactacctgttgccgtttgaattggcggcggtattgttactgttgggtatggtg
gccgcgattgcgctggttcaccgtaaaacggttaatccgaaacgcatggatcctgccgac
caagttaaagtacgcgccgaccaaggccgtatgcgtctggtgaaaatggaagcggtcaaa
ccgcaagttgaatctgacgaagaaagcgaagtttcagacggcctcaagccggaaggggag
ggcaaagcatga
DBGET
integrated database retrieval system