Neisseria dentiae: H3L92_05630 Help Entry H3L92_05630       CDS       T07671                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ndn  Neisseria dentiae Pathway ndn01100   Metabolic pathways ndn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ndn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L92_05630    00074 Mycolic acid biosynthesis     H3L92_05630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L92_05630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QMT46244 LinkDB All DBs Position complement(1196311..1196568) Genome browser AA seq 85 aa AA seqDB search MTLETQIKQMIIDSLGLEDITADDIETDAPLFGDEGLGLDSVDALELGLAVQKTFGFQLD GEKDNLRDHFASVQTLADFIRSRQV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactttagaaacccaaataaaacaaatgattatcgacagcttaggcttggaagacatc accgccgacgacatcgaaaccgatgcccccctgtttggcgacgaaggcttgggtctggat tcggtagatgccttggagcttggcctggccgttcagaaaactttcggtttccagctcgac ggcgaaaaagacaatctgcgcgaccatttcgccagcgtgcaaaccttggccgactttatc cgcagccgccaagtgtga

DBGET integrated database retrieval system