Novosphingobium decolorationis: HT578_00200 Help Entry HT578_00200       CDS       T07993                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ndr  Novosphingobium decolorationis Pathway ndr01100   Metabolic pathways ndr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ndr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HT578_00200    00074 Mycolic acid biosynthesis     HT578_00200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HT578_00200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QVM82335 UniProt:  A0ABX8DZN0 LinkDB All DBs Position 35714..35950 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVSDAIKYIDENKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgatcgggttaagaagatcgtcgtcgagcacctcggtgtggaagcc gacaaggtcaccgaagatgcaagcttcatcgatgatctgggtgccgattcgctcgacatc gtcgagctggtcatggcgttcgaagaagaattcggcgtcgaaatcccggacgatgccgct gaaaagatcagcaccgtctcggatgcgatcaagtacatcgacgagaacaagggctga

DBGET integrated database retrieval system