Novosphingobium decolorationis: HT578_03220 Help Entry HT578_03220       CDS       T07993                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism ndr  Novosphingobium decolorationis Pathway ndr00190   Oxidative phosphorylation ndr01100   Metabolic pathways Module ndr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ndr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HT578_03220  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ndr00194]     HT578_03220 Photosynthesis proteins [BR:ndr00194]  Photosystem and electron transport system   F-type ATPase [OT]    HT578_03220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QVM82848 LinkDB All DBs Position 716873..717130 Genome browser AA seq 85 aa AA seqDB search MALHFELVTPAKLVRSEDVHMVVVPGTEGEFGVLAGHAPFMSTVADGAIKVYKTENGIPE EIVISGGFAEVGDKGLTVLAEHVEN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgacgccggcgaagctcgttcgctcggaggacgtccac atggtcgtcgtccccggcaccgaaggtgagttcggtgttcttgccggtcacgcccccttc atgtcgaccgtcgccgatggcgcgatcaaggtctacaagaccgagaacggcattcccgaa gagatcgtgatctcgggcggctttgccgaagtcggcgacaagggcctgaccgtcctggcc gaacacgtcgagaactga

DBGET integrated database retrieval system