Novosphingobium decolorationis: HT578_15765 Help Entry HT578_15765       CDS       T07993                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ndr  Novosphingobium decolorationis Pathway ndr01100   Metabolic pathways ndr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ndr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HT578_15765    00074 Mycolic acid biosynthesis     HT578_15765   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HT578_15765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5666 Motif Other DBs NCBI-ProteinID:  QVM86267 LinkDB All DBs Position complement(3424067..3424306) Genome browser AA seq 79 aa AA seqDB search MDRQDVSARIIALIEPFNKKEVAITDATRFTDDLEFDSLTVMDFVAAIEDEFDIIISMNQ QAEIENFGQLVDAVMKLQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaccgccaagacgtttcggcccgcatcatcgccctgatcgaacccttcaacaagaag gaagtcgcgatcaccgacgccacgcgcttcaccgacgacctggaattcgacagcctgacc gtcatggacttcgtggccgccatcgaggacgaattcgacatcatcatctcgatgaaccag caggccgagatcgagaacttcggccagctcgtcgacgcggtgatgaagctgcagggctga

DBGET integrated database retrieval system