KEGG   Neobacillus drentensis: L1999_23275
Entry
L1999_23275       CDS       T08277                                 
Name
(GenBank) non-heme iron oxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
ndt  Neobacillus drentensis
Pathway
ndt00621  Dioxin degradation
ndt01100  Metabolic pathways
ndt01120  Microbial metabolism in diverse environments
ndt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ndt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    L1999_23275
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ULT55977
LinkDB
Position
complement(4871033..4871380)
AA seq 115 aa
MKFTKVCTLSDLPTDEGLKVVEEDTAVAVFNVNGEVFATQDRCSHAKWSLSEGGYLDGDV
IVCSLHMGKFCARTGAVKMAPPFKPLKKYPVQVDGEDVYVAFEDGYFEKKIVTNP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaatttacaaaggtttgcacgttgtctgatctaccgactgatgaggggctaaaggta
gtagaagaagatacggcagtagcggtgtttaacgtaaatggagaagtatttgcaacacaa
gaccgctgttctcacgccaaatggtcgctatctgaaggcggttatctggatggagatgtc
atcgtgtgctcattgcatatgggaaagttttgtgcccggacgggagctgtaaagatggca
cccccttttaaacctttgaaaaagtatccagtacaggttgatggagaagatgtatatgtg
gcttttgaagacgggtactttgaaaaaaaaatagtaaccaacccatga

DBGET integrated database retrieval system