Nitrosotalea devaniterrae: NDEV_0525 Help Entry NDEV_0525         CDS       T04889                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ndv  Nitrosotalea devaniterrae Pathway ndv03010   Ribosome Brite KEGG Orthology (KO) [BR:ndv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NDEV_0525 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NDEV_0525 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ndv03011]     NDEV_0525 (rps27ae)    04121 Ubiquitin system [BR:ndv04121]     NDEV_0525 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ndv04147]     NDEV_0525 (rps27ae) Ribosome [BR:ndv03011]  Ribosomal proteins   Eukaryotes    Small subunit     NDEV_0525 (rps27ae)   Archaea     NDEV_0525 (rps27ae) Ubiquitin system [BR:ndv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NDEV_0525 (rps27ae) Exosome [BR:ndv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NDEV_0525 (rps27ae)   Exosomal proteins of colorectal cancer cells    NDEV_0525 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 DUF1451 Ribosomal_L37e Ephrin_rec_like Baculo_ME53 Cas12f1-like_TNB Zn_Tnp_IS91 A2L_zn_ribbon Motif Other DBs NCBI-ProteinID:  CUR51290 UniProt:  A0A128A1T5 LinkDB All DBs Position 1:complement(466977..467150) Genome browser AA seq 57 aa AA seqDB search MAGKKGSSPSVYKYYKVSGEKVERIKKECSRCGKGVFMSNHKNRRSCGKCGFTEFNQ NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggcaggcaagaaaggatcaagcccatcagtgtacaagtattacaaagtttctggagaa aaagtagagagaatcaaaaaagaatgctcaagatgtggcaagggtgtattcatgtccaac cacaaaaacagacgaagctgtggcaaatgtggttttactgaatttaatcaataa

DBGET integrated database retrieval system