Nocardiopsis eucommiae: KGD82_22435 Help Entry KGD82_22435       CDS       T08767                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism nec  Nocardiopsis eucommiae Brite KEGG Orthology (KO) [BR:nec00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nec03032]     KGD82_22435    03036 Chromosome and associated proteins [BR:nec03036]     KGD82_22435    03400 DNA repair and recombination proteins [BR:nec03400]     KGD82_22435 DNA replication proteins [BR:nec03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KGD82_22435 Chromosome and associated proteins [BR:nec03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KGD82_22435 DNA repair and recombination proteins [BR:nec03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KGD82_22435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding DUF2267 Motif Other DBs NCBI-ProteinID:  QVJ01028 UniProt:  A0A975L8V8 LinkDB All DBs Position complement(4887369..4887650) Genome browser AA seq 93 aa AA seqDB search MNKRDLIDAISDRLGDKKTATEAVNAVLETIQATVASGDKVAITGFGVFEKSERAARTAR NPATGATINVPASFVPKFRAGADFKALVNGDKK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcgtgacctgatcgacgcgatctccgaccgtctcggagacaagaagaccgcg accgaagcggtcaacgctgtgcttgagaccattcaggccaccgtggcgtcgggcgacaag gtcgccatcacgggcttcggcgttttcgagaagtccgagcgtgcggctcgtaccgcgcgc aaccccgccactggcgccacgatcaacgtccccgcgagcttcgttccgaagttccgcgct ggcgctgacttcaaggcgctcgtcaacggcgacaagaagtag

DBGET integrated database retrieval system