Nostoc edaphicum: HUN01_26830 Help Entry HUN01_26830       CDS       T07001                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ned  Nostoc edaphicum Pathway ned00998   Biosynthesis of various antibiotics ned01100   Metabolic pathways ned01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ned00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUN01_26830 (acpP)    00074 Mycolic acid biosynthesis     HUN01_26830 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUN01_26830 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF6137 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QMS91023 UniProt:  A0A7D7QVX9 LinkDB All DBs Position 5698101..5698355 Genome browser AA seq 84 aa AA seqDB search MSQAELFEKVKKIVVEQLSVDPPDKVTPQSKFMEDLGADSLDTVELVMALEEEFDIEIPD EAAEQITSVQDAVDYINNKVTASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcggaactttttgaaaaggtcaagaaaatcgtcgtcgaacaactcagtgtt gacccccctgataaagtcacaccacaatccaagtttatggaagacctgggagcagattcc ctggataccgttgaattggtgatggccttggaagaagaatttgatatcgaaattcccgac gaagctgccgaacagattacatcggttcaagacgcagtagattacatcaataacaaagtt accgcatcagcttaa

DBGET integrated database retrieval system